For Research Purposes Only — Not for Human Consumption — UK Research Supply

ACE-003

Sermorelin

GHRH analogue. 29 amino acid synthetic peptide.

Analytical Data
PURITY (HPLC)99.3%
BATCH NO.ACE-003-B240110
FORMULAC149H246N44O42S
MOL. WEIGHT3357.93 g/mol
CAS NO.86168-78-7
SEQUENCEYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
COA available at lab-results — Batch: ACE-003-B240110

Product Information

Sermorelin (GHRH 1-29) is a synthetic analogue of the endogenous peptide growth hormone releasing hormone (GHRH), consisting of the first 29 amino acids of endogenous GHRH. This research compound is supplied as a lyophilised (freeze-dried) powder for reconstitution. Purity verified by HPLC analysis with certificate of analysis included. For research purposes only. Not for human consumption.
Starting from£29.99
1
Total£29.99

UK Tracked Shipping

Dispatched within 48 hours — discreet packaging

HPLC Verified — 99.3% Purity

Batch ACE-003-B240110 — COA included

Secure Checkout

SSL encrypted — Stripe payment processing in GBP

Storage

Store lyophilised peptide at -20°C. Upon reconstitution, use within manufacturer guidance. Keep away from light and moisture.

Research Use Only

This compound is for in-vitro research and laboratory use only. Not intended for human consumption, veterinary use, or as a food supplement. By purchasing you confirm you are a qualified researcher aged 18+.