ACE-003
Sermorelin
GHRH analogue. 29 amino acid synthetic peptide.
Analytical Data
PURITY (HPLC)99.3%
BATCH NO.ACE-003-B240110
FORMULAC149H246N44O42S
MOL. WEIGHT3357.93 g/mol
CAS NO.86168-78-7
SEQUENCEYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
COA available at lab-results — Batch: ACE-003-B240110
Product Information
Sermorelin (GHRH 1-29) is a synthetic analogue of the endogenous peptide growth hormone releasing hormone (GHRH), consisting of the first 29 amino acids of endogenous GHRH.
This research compound is supplied as a lyophilised (freeze-dried) powder for reconstitution. Purity verified by HPLC analysis with certificate of analysis included.
For research purposes only. Not for human consumption.
Starting from£29.99
1
Total£29.99
UK Tracked Shipping
Dispatched within 48 hours — discreet packaging
HPLC Verified — 99.3% Purity
Batch ACE-003-B240110 — COA included
Secure Checkout
SSL encrypted — Stripe payment processing in GBP
Storage
Store lyophilised peptide at -20°C. Upon reconstitution, use within manufacturer guidance. Keep away from light and moisture.
Research Use Only
This compound is for in-vitro research and laboratory use only. Not intended for human consumption, veterinary use, or as a food supplement. By purchasing you confirm you are a qualified researcher aged 18+.